Bacterial taxon 1392858
Locus CO715_05695
Protein ATI05264.1
hypothetical protein
Escherichia coli M12
Length 81 aa, Gene n/a, UniProt n/a
>ATI05264.1|Escherichia coli M12|hypothetical protein
MTAKHTKKSQSHALDLTEHWLRVSIKIIDRNAGEGYAKAHPELISAFMTTAAANFATLTEREIAEAEQVTTINVKTGEQTA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.38 | 4.1e-10 | ●●○○○ -1.62 | -1.6194198513709446 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.14 | 0.00027 | ○○○○○ 1.2 | 1.2004310312024151 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)