Bacterial taxon 1392858
Locus CO715_05940
Protein ATI08743.1
hypothetical protein
Escherichia coli M12
Length 97 aa, Gene n/a, UniProt n/a
>ATI08743.1|Escherichia coli M12|hypothetical protein
MDITPFLHALCAVAAQVLVGLFTGNWVYGAIAGCTFFIAREHTQAEYRWIEMFGHGKRMNMPWWGGFDLRAWDVASLMDFAVPVVACLLVWLLVNRV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.13 | 1.7e-6 | ○○○○○ 0.1 | 0.10128382813941403 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.52 | 0.02 | ○○○○○ 0.86 | 0.8630504261620066 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)