Bacterial taxon 1392858
Locus CO715_07045
Protein ATI05492.1
hypothetical protein
Escherichia coli M12
Length 99 aa, Gene n/a, UniProt n/a
>ATI05492.1|Escherichia coli M12|hypothetical protein
MEQTNYSKLSQRDVDRAETDLLINLSTLTQRGLAKMIGCHESKISRTDWRFIASVLCAFGMASDISPISRAFKYALDEITNKKRPVCKTERSEQIQMEF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.7 | 0.00043 | ●●●○○ -2.1 | -2.103895896456801 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.55 | 0.0089 | ●●○○○ -1.45 | -1.4466609515728877 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)