Bacterial taxon 1392858
Locus CO715_07215
Protein ATI05525.1
hypothetical protein
Escherichia coli M12
Length 153 aa, Gene n/a, UniProt n/a
>ATI05525.1|Escherichia coli M12|hypothetical protein
MSQDSKVFFRIFLGIGLVLILISVVIFYNQFTYSKDAIHTEGVIVDTVWHSSHSHRTGKNGSWYPVVAFRPTPDYTLIFNSSIGSDFYEDSEGDKVNVYYSPGHPEKAEINNPWVNFFKWGFIGIMGVIFIAVGLLISMPSSKKSRRKRKSRP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -11.81 | 3.2e-8 | ●●○○○ -1.92 | -1.9188268818180607 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.39 | 0.023 | ●○○○○ -0.16 | -0.16014962771440908 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)