Bacterial taxon 1392858
Locus CO715_07405
Protein ATI05556.1
hypothetical protein
Escherichia coli M12
Length 148 aa, Gene n/a, UniProt n/a
>ATI05556.1|Escherichia coli M12|hypothetical protein
MRTVLNILNFVLGGFATTLGWLLATLVSIVLIFTLPLTRSCWEITKLSLVPYGNEAIHVDELNPAGKNVLLNTGGTVLNIFWLIFFGWWLCLMHIATGIAQCISIIGIPVGIANFKIAAIALWPVGRRVVSVETAQAAREANARRRFE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.29 | 4.1e-26 | ●●○○○ -1.39 | -1.3915784038111885 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.4 | 1.1e-21 | ●○○○○ -0.79 | -0.7898432987174723 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)