Bacterial taxon 1392858
Locus CO715_07890
Protein ATI05638.1
hypothetical protein
Escherichia coli M12
Length 120 aa, Gene n/a, UniProt n/a
>ATI05638.1|Escherichia coli M12|hypothetical protein
MASERSTDVQAFIGELDGGVFETKIGAVLSEVASGVMNTKTKGKVSLNLEIEPFDENRVKIKHKLSYVRPTNRGKISEEDTTETPMYVNRGGRLTILQEDQGQLLTLAGEPDGKLRAAGR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.31 | 4.5e-13 | ●●●○○ -2.02 | -2.0214807208285004 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.23 | 8.3e-13 | ●●○○○ -1.17 | -1.1699963366788975 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)