Bacterial taxon 1392858
Locus CO715_08535
Protein ATI05756.1
hypothetical protein
Escherichia coli M12
Length 125 aa, Gene n/a, UniProt n/a
>ATI05756.1|Escherichia coli M12|hypothetical protein
MKHKQRWAGAICCFVLFIVVCLFLATHMKGAFRAAGHPEIGLLFFILPGAVASFFSQRREVLKPLFGAMLAAPCSMLIMRLFFSPTRSFWQELAWLLSAVFWCALGALCFLFISSLFKPQHRKNQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.13 | 2.0e-10 | ●●○○○ -1.36 | -1.3594469176168635 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.67 | 6.7e-9 | ●○○○○ -0.85 | -0.846177722564665 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)