Bacterial taxon 1392858
Locus CO715_09195
Protein ATI05871.1
hypothetical protein
Escherichia coli M12
Length 140 aa, Gene n/a, UniProt n/a
>ATI05871.1|Escherichia coli M12|hypothetical protein
MIPSQISFNTLPVNATYASETTVDTQKFSDILYSAGCSLKDLAYLSRCLASIHPTIAKNIYETENLSDQKLLHIDCRSTNEIKINIFFGQQREGLIEISSDTVIFSILSSLIDSTISKFQHQNPVNGSVNPDLLYEDYTD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.83 | 2.7e-16 | ●●○○○ -1.09 | -1.0884157451075929 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.72 | 6.6e-14 | ●○○○○ -0.65 | -0.6471294249712514 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)