Bacterial taxon 1392858
Locus CO715_09355
Protein ATI05899.1
hypothetical protein
Escherichia coli M12
Length 218 aa, Gene n/a, UniProt n/a
>ATI05899.1|Escherichia coli M12|hypothetical protein
MQRARCYLIGETAVVLELEPPVTLASQKRIWRLAQRLVDMPNVVEAIPGMNNITVILRNPESLALDAIERLQRWWEESEALEPESRFIEIPVVYGGAGGPDLAVVAAHCGLSEKQVVELHSSVEYVVWFLGFQPGFPYLGSLPEQLHTPRRAEPRLLVPAGSVGIGGPQTGVYPLATPGGWQLIGHTSLSLFDPARDEPILLRPGDSVRFVPQKEGVC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.39 | 0.00039 | ●●○○○ -1.2 | -1.2033796989587153 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.97 | 0.0014 | ●●○○○ -1.12 | -1.1157483729741937 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)