Bacterial taxon 1392858
Locus CO715_09380
Protein ATI05904.1
hypothetical protein
Escherichia coli M12
Length 135 aa, Gene n/a, UniProt n/a
>ATI05904.1|Escherichia coli M12|hypothetical protein
MKNKETLKQIYHLQYDSFAFKSGLINWYNSLLDKTPDELDENDIAKMLRQNILPALAVQKAIEMIEINLMVGYLYNGELLLVLSNLIGSDYFSPLHLLQLKNIISKFYGNMLNASTMSDEEKKLFIATMKFIMSY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.01 | 0.026 | ○○○○○ 0.76 | 0.7566409588950872 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.5 | 4.9e-10 | ○○○○○ 1.07 | 1.0673148741116416 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)