Bacterial taxon 1392858
Locus CO715_10085
Protein ATI06024.1
hypothetical protein
Escherichia coli M12
Length 68 aa, Gene n/a, UniProt n/a
>ATI06024.1|Escherichia coli M12|hypothetical protein
MHKDQYTDAPSQEQVRVKTMLNSTISMGYPDVVIACIEHQVSLEAFRAIEAALVKHDKNTKDYSLVVD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.5 | 3.9e-24 | ●●○○○ -1.23 | -1.2269566985688365 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.47 | 0.045 | ○○○○○ 0.24 | 0.24003342761490676 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)