Bacterial taxon 1392858
Locus CO715_10285
Protein ATI06053.1
hypothetical protein
Escherichia coli M12
Length 108 aa, Gene n/a, UniProt n/a
>ATI06053.1|Escherichia coli M12|hypothetical protein
MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVYAAYGGVYVCTALMWLRVVDGVKLSLYDWTGALIALCGMLIIVAGWGRA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.61 | 6.1e-24 | ●●○○○ -1.88 | -1.8766803869397908 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.21 | 4.5e-29 | ●●○○○ -1.58 | -1.5847846130056336 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)