Bacterial taxon 1392858
Locus CO715_10290
Protein ATI06054.1
hypothetical protein
Escherichia coli M12
Length 113 aa, Gene n/a, UniProt n/a
>ATI06054.1|Escherichia coli M12|hypothetical protein
MKITLSKRIGLLAFLLPCALALSTTVHAETNKLVIESGDSAQSRQHAAMEKEQWNDTRNLRQKVNKRTEKEWDKADAAFDNRDKCEQSANINAYWEPNTLRCLDRRTGRVITP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.84 | 0.021 | ●●○○○ -1.51 | -1.5077942337478039 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.42 | 0.04 | ●●○○○ -1.42 | -1.4201629077632822 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)