Bacterial taxon 1392858
Locus CO715_10915
Protein ATI06163.1
hypothetical protein
Escherichia coli M12
Length 58 aa, Gene n/a, UniProt n/a
>ATI06163.1|Escherichia coli M12|hypothetical protein
MEGKNGLKIVCDSGAGFSTEQAVFLANNLAKKMRSLKQKCNLRQYSYSMTVQSCIQCK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.06 | 1.3e-9 | ●●○○○ -1.55 | -1.5524444807970603 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.44 | 1.2e-12 | ●●○○○ -1.42 | -1.4243358280482596 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)