Bacterial taxon 1392858
Locus CO715_11085
Protein ATI06197.1
hypothetical protein
Escherichia coli M12
Length 267 aa, Gene n/a, UniProt n/a
>ATI06197.1|Escherichia coli M12|hypothetical protein
MFSTNLIQSDYGNLNIKNLAFDSFKERLQSTMTALTFFISTGQCACDEIAESNFNYMIAYMSNINYDASKPGAPALSFDTYLQDNVKYRVIINNLYGSEIRIRGINENFVGMDFTCEFRPEKMTNLINIKNRLVIHYLKTIYYEQNYIHPVGSIFAAIQKNESLLKFPSVISILNVNLLFNPLNLPGMGSGVLEEIMSISDSSLRKRLGYEVLSFSLQAHSLSQECIDKLAIFFADDLFKYESVCIAAMEHLKSKATAPIQNGPLPA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.04 | 1.7e-18 | ●●○○○ -1.13 | -1.1307708860001118 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.07 | 1.7e-8 | ●○○○○ -0.3 | -0.3022375634178836 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)