Bacterial taxon 1392858
Locus CO715_11450
Protein ATI06266.1
hypothetical protein
Escherichia coli M12
Length 119 aa, Gene n/a, UniProt n/a
>ATI06266.1|Escherichia coli M12|hypothetical protein
MLQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVMHGAVKYLGYADEHSTEPDQVILIEAGQFAVFPPEKWHNIEAMTDDTYFNIDFFVAPEVLMEGAQQRKVIHNGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.57 | 3.5e-8 | ○○○○○ 0.22 | 0.2183342421330252 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.86 | 0.0043 | ○○○○○ 0.37 | 0.36647291224971673 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)