Bacterial taxon 1392858
Locus CO715_11610
Protein ATI06294.1
hypothetical protein
Escherichia coli M12
Length 95 aa, Gene n/a, UniProt n/a
>ATI06294.1|Escherichia coli M12|hypothetical protein
MNEVVNSGVMNIASLVVSVVVLLIGLILWFFINRASSRTNEQIELLEALLDQQKRQNALLRRLCEANEPEKADKKTVESQKSVEDEDIIRLVAER
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -11.08 | 9.3e-11 | ●●○○○ -1.76 | -1.764846123302401 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.06 | 8.5e-10 | ●●○○○ -1.55 | -1.5532790648540555 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)