Bacterial taxon 1392858
Locus CO715_12205
Protein ATI06404.1
hypothetical protein
Escherichia coli M12
Length 337 aa, Gene n/a, UniProt n/a
>ATI06404.1|Escherichia coli M12|hypothetical protein
MRKAISRVTNNNSLSEMKNELEALKKALSEKDYLINSLNEDSLALQVQLEISQGKSAQLAVDNAALNVRVNELEEGYQTKNSELAMLSKLFFKSEENSQRIAAQLKKSHLELDCCKSELSKTKAALDISQTKLKKIESELGLLKKSHSKIKQKLEDELGKLKSQLVKEKESNNLLSTQATVLQDDLNLRFSELAKLSNILEVKDRQLLAKDNELSIYKEQLDKLKKSFAWKAVAPVRALSYKFKKKNTKSLLRQHVEVIQNSGLFSIDWYRKNYPEIDEYSISPIEHYLTIGFKLGLTPSERFDGNDYLARYPDVQQEGVNPLLHYLMFGKNEGRTF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.08 | 1.7e-23 | ○○○○○ 0.98 | 0.980935424212613 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.04 | 4.3e-50 | ○○○○○ 1.18 | 1.1810269518772711 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)