Bacterial taxon 1392858
Locus CO715_12520
Protein ATI06456.1
hypothetical protein
Escherichia coli M12
Length 99 aa, Gene n/a, UniProt n/a
>ATI06456.1|Escherichia coli M12|hypothetical protein
MSSKVERERRKAQLLSQIQQQRLDLSASRREWLEATGAYDRRWNMLLSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGLWSAWRLVKTTLKQQQLRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.54 | 1.9e-6 | ●●○○○ -1.44 | -1.443322615344906 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.62 | 0.00016 | ●●○○○ -1.04 | -1.042930914001341 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)