Bacterial taxon 1392858
Locus CO715_12555
Protein ATI06463.1
hypothetical protein
Escherichia coli M12
Length 54 aa, Gene n/a, UniProt n/a
>ATI06463.1|Escherichia coli M12|hypothetical protein
MSKKSAKKRQPVKPVVAKEPARTANNFGYEEMLSELEAIVADAETRLAEDEATA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.82 | 0.009 | ●●○○○ -1.71 | -1.7112240976404438 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.05 | 0.041 | ●●○○○ -1.34 | -1.3410860683629637 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)