Bacterial taxon 1392858
Locus CO715_13525
Protein ATI06636.1
hypothetical protein
Escherichia coli M12
Length 226 aa, Gene n/a, UniProt n/a
>ATI06636.1|Escherichia coli M12|hypothetical protein
MSDQNVNPYLSGADAASQQSPYMAAPVGADNGASRFSSAPADADFLRTQPVNGNDGGQWNNGNIANQQDQNADSSGAQVGDTLQLQDGTTVELTPELHGLMGQFHQSVESQLGQGTVGAMLQYAGKLDAGTQSTLERMVMSGDPAQMSRAVQYLQERMAGGSITGYVPSGQTAAQPVGMSHAEFIAAYDQLSQWAQQSGYGPGHRQYDEQYRALVAQRSAGKRAGR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.58 | 6.7e-11 | ●●○○○ -1.45 | -1.452085747943358 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.22 | 1.8e-7 | ○○○○○ 1.01 | 1.0101458662074538 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)