Bacterial taxon 1392858
Locus CO715_13545
Protein ATI06639.1
hypothetical protein
Escherichia coli M12
Length 69 aa, Gene n/a, UniProt n/a
>ATI06639.1|Escherichia coli M12|hypothetical protein
MTKSEFEAGAWELKTLLLGALTRRLKEDEAGESRMAAAELSSCVNFLKQNAADSPDTTFNNVFPEDDDQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.97 | 7.6e-7 | ●●○○○ -1.53 | -1.5342922775574093 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.4 | 3.0e-6 | ●●○○○ -1.21 | -1.2065093891724483 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)