Bacterial taxon 1392858
Locus CO715_13550
Protein ATI06640.1
hypothetical protein
Escherichia coli M12
Length 145 aa, Gene n/a, UniProt n/a
>ATI06640.1|Escherichia coli M12|hypothetical protein
MPVTEHAQRRAARADALITAQLAFALNGYNWDELAEPHRKTLNREAIIREVSTPLERYCLLNDCEPWECLAAVLNRMKRPDGSRRWKAIRLSDRIFNGRVHPVRKTPDEVYAAIARRLFLPKPVHQEVIQHIRALGLLPVGDNHQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.28 | 3.9e-10 | ●●○○○ -1.81 | -1.8082444942661644 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.87 | 5.1e-9 | ●●○○○ -1.72 | -1.7208218142958913 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)