Bacterial taxon 1392858
Locus CO715_13855
Protein ATI06695.1
hypothetical protein
Escherichia coli M12
Length 303 aa, Gene n/a, UniProt n/a
>ATI06695.1|Escherichia coli M12|hypothetical protein
MLPRIRHNNFIGAVELFVKSSHTKTHSNNFFNNIQHAFNKKDWISNYDSLLTLREFFRCATQIDKNSYQVLSSKNENVHAMDKFLISFSLKDNGAEYIMTLRGSGFEYEEIPITINEYNSFMDFKNREFPLEQNRRLYAWDILQKKQSDIPERIKGYIRQAFGDVSLGYAVLDDIVSKLKRGKFDLQIPGGGIKECDGWYIYEKIIDDNFAIVIESLGFALKIYGGDERFRNGSSVVLEDEDYSLIYNFLVNAGCQQVELAEQVDAIVSANLAADSDITEEKICEKYKSTIEAFKKKQLALPV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.61 | 0.00049 | ○○○○○ 0.42 | 0.4190517078404297 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.35 | 0.00073 | ○○○○○ 0.83 | 0.8273719577254512 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)