Bacterial taxon 1392858
Locus CO715_15050
Protein ATI06915.1
hypothetical protein
Escherichia coli M12
Length 78 aa, Gene n/a, UniProt n/a
>ATI06915.1|Escherichia coli M12|hypothetical protein
MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLEDAIADMARKYNASSWKVTSMRIDNNSTATAVLYK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.86 | 2.1e-5 | ○○○○○ 0.73 | 0.7251354107435092 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.75 | 9.4e-46 | ○○○○○ 1.12 | 1.1198936697023547 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)