Bacterial taxon 1392858
Locus CO715_15260
Protein ATI06952.1
hypothetical protein
Escherichia coli M12
Length 290 aa, Gene n/a, UniProt n/a
>ATI06952.1|Escherichia coli M12|hypothetical protein
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAAFPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSIDSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNVLRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQLIYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.59 | 2.0e-11 | ●●○○○ -1.66 | -1.6634441603774544 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.1 | 0.0044 | ○○○○○ 0.98 | 0.9836478223978482 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)