Bacterial taxon 1392858
Locus CO715_15290
Protein ATI06957.1
hypothetical protein
Escherichia coli M12
Length 72 aa, Gene n/a, UniProt n/a
>ATI06957.1|Escherichia coli M12|hypothetical protein
MGRILLNLSNELFKQLDDLEVQRNLPRAELLREAVDQYLVNQSQTARASAFGIWQGSEEDGVEYQRKLREEW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.36 | 0.018 | ○○○○○ 0.62 | 0.620186465576332 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.85 | 1.4e-9 | ○○○○○ 0.72 | 0.7236748886437672 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)