Bacterial taxon 1392858
Locus CO715_15485
Protein ATI08828.1
hypothetical protein
Escherichia coli M12
Length 224 aa, Gene n/a, UniProt n/a
>ATI08828.1|Escherichia coli M12|hypothetical protein
MQNIILLILYLFLIAVNHFRYKFLLSGNTGEMILYFANVFFNPLALSFIIATIICITIKKRSSRSFIRGTCWLMGLFLIYSSYTVWERHSTWDYSFPGPGITVTVPSKQWVANIVKQGPTLVTRDAHAILAIVAFSQNEVGVHSIEELTATQNGTAEMHVCDVQGFACAYQEGVQTMSDGKVRHAIFMTLLDNTNLIQLVAAIDPDYLDEYQEEVMKMMLSARQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.47 | 1.6e-6 | ○○○○○ 0.64 | 0.6437634651864533 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.68 | 1.2e-64 | ○○○○○ 0.9 | 0.8960164964133265 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)