Bacterial taxon 1392858
Locus CO715_15770
Protein ATI07038.1
hypothetical protein
Escherichia coli M12
Length 67 aa, Gene n/a, UniProt n/a
>ATI07038.1|Escherichia coli M12|hypothetical protein
MKNVFKALTVLLTLFSLTGCGLKGPLYFPPADKNAPPPTKPVETQTQSTVPDKNDRATGDGPSQVNY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.99 | 0.004 | ●●○○○ -1.33 | -1.3294018915650279 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.57 | 0.0098 | ●●○○○ -1.24 | -1.2419792115947548 | 29101196 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)