Bacterial taxon 1392858
Locus CO715_15830
Protein ATI07049.1
hypothetical protein
Escherichia coli M12
Length 155 aa, Gene n/a, UniProt n/a
>ATI07049.1|Escherichia coli M12|hypothetical protein
MSAVLTAEQALKLVGEMFVYHMPFNRALGMELERYEKEFAQLAFKNQPMMVGNWAQSILHGGVIASALDVAAGLVCVGSTLTRHETISEDELRQRLSRMGTIDLRVDYLRPGRGERFTATSSLLRAGNKVAVARVELHNEEQLYIASATATYMVG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.23 | 0.00024 | ○○○○○ 0.29 | 0.29010847103463344 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.73 | 4.8e-25 | ○○○○○ 0.91 | 0.9077006732112629 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)