Bacterial taxon 1392858
Locus CO715_16815
Protein ATI07234.1
hypothetical protein
Escherichia coli M12
Length 142 aa, Gene n/a, UniProt n/a
>ATI07234.1|Escherichia coli M12|hypothetical protein
MSEALSLFSLFASSFLSATLLPGNSEVVLVAMLLSGISHPWVLVLTATMGNSLGGLTNVILGRFFPLRKTSRWQEKATGWLKRYGAVTLLLSWMPVVGDLLCLLAGWMRISWGPVIFFLCLGKALRYVAVAAATVQGMMWWH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.24 | 0.00034 | ●●○○○ -1.17 | -1.1735433189211284 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.84 | 0.047 | ○○○○○ 1.35 | 1.3462745951623691 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)