Bacterial taxon 1392858
Locus CO715_17620
Protein ATI07377.1
hypothetical protein
Escherichia coli M12
Length 160 aa, Gene n/a, UniProt n/a
>ATI07377.1|Escherichia coli M12|hypothetical protein
MIDYKKNLLFILVFISGFILFIVYSYTAEKMIYNETCTANWVIFNDKGRANLTIDFMYNKKNKTGTVALSGTWQQGNRESKSIRRNIEYTWIENYDTAHLTSKKVNKFEIMDQVDDDRLAELIPDFYVFPEKSVSYNILKQGKHAFILSIGNRAIMHCAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.63 | 0.00047 | ○○○○○ 0.89 | 0.8857928417151324 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.54 | 1.0e-8 | ○○○○○ 1.08 | 1.0754520686673472 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)