Bacterial taxon 1392858
Locus CO715_17700
Protein ATI07390.1
hypothetical protein
Escherichia coli M12
Length 110 aa, Gene n/a, UniProt n/a
>ATI07390.1|Escherichia coli M12|hypothetical protein
MSVSNMPPIDRAEQSAAREIQQAKVIDLNDRVLNLDNPDDKMISAFANYAVQTENWQQNALQALRSDKKGLTPEKLLVLQDHVLNYNVEVSLVGTLARKIVAAVETLTRS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.47 | 2.5e-41 | ●●○○○ -1.22 | -1.220697318141371 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.17 | 3.4e-29 | ○○○○○ 1 | 0.9997135654950106 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)