Bacterial taxon 1392858
Locus CO715_18470
Protein ATI07528.1
hypothetical protein
Escherichia coli M12
Length 127 aa, Gene n/a, UniProt n/a
>ATI07528.1|Escherichia coli M12|hypothetical protein
MYAKSFLALDGNGRLTGARTAQTAPYAHYTCHLCGSALRYHPQYDTERPWFEHTDDGLTEHAQQCPYVRPERREIRLIKRLQQFVPDALPVVRKASWHCRQCHHDYYGERYCTHCQTGRFSEEGGAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.71 | 9.1e-5 | ●○○○○ -0.23 | -0.22858552038803562 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.09 | 0.04 | ○○○○○ 0.11 | 0.11067289878061276 | 29101196 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)