Bacterial taxon 1392858
Locus CO715_19490
Protein ATI07710.1
hypothetical protein
Escherichia coli M12
Length 57 aa, Gene n/a, UniProt n/a
>ATI07710.1|Escherichia coli M12|hypothetical protein
MSEFDAQRVAERIDIVLDILVAGDYHSAIHNLEILKAELLRQVAESTPDIPKAPWEI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.46 | 8.1e-14 | ●●○○○ -1.43 | -1.4278828102904901 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.71 | 0.00054 | ●○○○○ -0.23 | -0.22775093633104018 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)