Bacterial taxon 1392858
Locus CO715_19545
Protein ATI07721.1
hypothetical protein
Escherichia coli M12
Length 55 aa, Gene n/a, UniProt n/a
>ATI07721.1|Escherichia coli M12|hypothetical protein
MVGQEQLESSPLCQHSDNEPETKRECSVVIPDDWQLTTQQQAFIELFGEDDQPKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.52 | 4.9e-8 | ●●○○○ -1.23 | -1.2315469108823116 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.09 | 2.1e-7 | ●●○○○ -1.14 | -1.1426637088122966 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)