Bacterial taxon 1392858
Locus CO715_19940
Protein ATI07789.1
hypothetical protein
Escherichia coli M12
Length 123 aa, Gene n/a, UniProt n/a
>ATI07789.1|Escherichia coli M12|hypothetical protein
MKHGIKALLITLSLACAGMSHSALAAAPAAKPTTVETKAEAPAAQSKAAVPAKASDEEGSRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVERNLAVLTL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.6 | 8.5e-13 | ●●○○○ -1.04 | -1.0398012237876082 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.44 | 0.021 | ○○○○○ 0.85 | 0.8467760370505953 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)