Bacterial taxon 1392858
Locus CO715_19990
Protein ATI07799.1
hypothetical protein
Escherichia coli M12
Length 192 aa, Gene n/a, UniProt n/a
>ATI07799.1|Escherichia coli M12|hypothetical protein
MFKKILFPLVALFMLAGCAKPPTTIEVSPTMTLPQQDPSLMGVTVSINGADQRTDQALAKVTRDNQIVTLTASRDLRFLLQEVLEKQMTARGYMVGPNGPVNLQIIVSQLYADVSQGNVRYNIATKADIAIIATAQNGNKMTKNYRASYNVEGAFQASNKNIADAVNSVLTDTIADMSQDTSIHEFIKQNAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.79 | 5.1e-13 | ●●○○○ -1.08 | -1.0788180284521454 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.37 | 2.5e-11 | ●○○○○ -0.99 | -0.9907694104391257 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)