Bacterial taxon 1392858
Locus CO715_21735
Protein ATI08118.1
hypothetical protein
Escherichia coli M12
Length 181 aa, Gene n/a, UniProt n/a
>ATI08118.1|Escherichia coli M12|hypothetical protein
MKRSIIAAAVFSSFFMSAGVFAADVDTGTLTIKGNIAESPCKFEAGGDSVSINMPTVPTTVFEGKAKYSTYDDAVGVTSSMLKISCPKEVAGVKLSLITNDKITGNDKAIASSNDTVGYYLYLGDNSDVLDVSAPFNIESYKTAEGQYAIPFKAKYLKLTDNSVQSGDVLSSLVMRVAQDK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.39 | 1.5e-235 | ●●○○○ -1.21 | -1.2050488670727064 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.19 | 3.9e-5 | ○○○○○ 0.3 | 0.29761972754759247 | 29101196 |
Retrieved 2 of 2 entries in 7.4 ms
(Link to these results)