Bacterial taxon 1392858
Locus CO715_21865
Protein ATI08143.1
hypothetical protein
Escherichia coli M12
Length 110 aa, Gene n/a, UniProt n/a
>ATI08143.1|Escherichia coli M12|hypothetical protein
MAGWFELSKSSDNQFRFVLKAGNGETILTSELYTSKASAEKGIASVRSNSPQEERYEKKTASNGKFYFNLKAANHQIIGSSQMYATAQSRETGIASVKANGTSQTVKDNT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.74 | 0.00023 | ○○○○○ 1.33 | 1.3266618698229762 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.68 | 1.3e-6 | ○○○○○ 1.52 | 1.5232064152454035 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)