Bacterial taxon 1392858
Locus CO715_22455
Protein ATI08248.1
hypothetical protein
Escherichia coli M12
Length 62 aa, Gene n/a, UniProt n/a
>ATI08248.1|Escherichia coli M12|hypothetical protein
MNNNEPDTLPDPAIGYIFQNDILALKQAFSLPDIDYADISQREQLAAALKRWPLLAEFAQQK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.77 | 1.7e-16 | ●●○○○ -1.28 | -1.2843343524872735 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.61 | 2.7e-15 | ●○○○○ -0.83 | -0.8330330236669867 | 29101196 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)