Bacterial taxon 1392858
Locus CO715_22950
Protein ATI08332.1
hypothetical protein
Escherichia coli M12
Length 255 aa, Gene n/a, UniProt n/a
>ATI08332.1|Escherichia coli M12|hypothetical protein
MTYSIGIDSGSTTTKGILLADGVITRRFLVPTPFRPATAITEAWETLREGLETTPFLTLTGYGRQLVDFADKQVTEISCHGLGARFLEPATRAVIDIGGQDSKVIQLDDDGNLCDFLMNDKCAAGTGRFLEVISRTLGTSVEQLDSITENVTPHAITSMCTVFAESEVISLRSAGVAPEAILAGVINAMARRSANFIARLSCEAPILFTGGVSHCQTFARMLESHLGMPVNTHPDAQFAGAIGAAVIGQRQRKRA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.25 | 0.00026 | ○○○○○ 0.08 | 0.07645495244379959 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.26 | 0.00057 | ○○○○○ 0.28 | 0.28405773662141653 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)