Bacterial taxon 1392858
Locus CO715_23260
Protein ATI08385.1
hypothetical protein
Escherichia coli M12
Length 73 aa, Gene n/a, UniProt n/a
>ATI08385.1|Escherichia coli M12|hypothetical protein
MKIITRGEAMRIHRQHPASRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDSFGPYVRLMSVTLN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.72 | 1.6e-5 | ●●○○○ -1.9 | -1.9000487405356632 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.94 | 0.0004 | ●●○○○ -1.53 | -1.5267810210444503 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)