Bacterial taxon 1392858
Locus CO715_23495
Protein ATI08413.1
hypothetical protein
Escherichia coli M12
Length 140 aa, Gene n/a, UniProt n/a
>ATI08413.1|Escherichia coli M12|hypothetical protein
MMNSSIKSFSLLAVILLAGCSSPTSRIADCQAQGVSHDTCYLAEQQRQAAILSASEAQAFKNAEAAQHAQAAKKSIYKGFGMTFRMSSKNFAYLNDSLCAIDEDNKDATVYQSGLYNVIVYHHTGKVALMKEGQFVGYLK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.97 | 0.005 | ○○○○○ 0.34 | 0.3443564347393374 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.87 | 6.2e-29 | ○○○○○ 1.35 | 1.3537858516753283 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)