Bacterial taxon 1392858
Locus CO715_24190
Protein ATI08539.1
hypothetical protein
Escherichia coli M12
Length 180 aa, Gene n/a, UniProt n/a
>ATI08539.1|Escherichia coli M12|hypothetical protein
MAKSALFTVRNNESCPKCGAELVIRSGKHGPFLGCSQYPACDYVRPLKSSADGHIVKVLEGQVCPACGANLVLRQGRFGMFIGCSNYPECEHTELIDKPDETAITCPQCRTGHLVQRRSRYGKTFHSCDRYPECQFAINFKPIAGECPECHYPLLIEKKTAQGVKHFCASKQCGKPVSAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -11.15 | 0.00022 | ●●○○○ -1.78 | -1.7804945743710656 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.59 | 0.027 | ●○○○○ -0.62 | -0.6204227351473971 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)