Bacterial taxon 1392858
Locus CO715_24730
Protein ATI08631.1
hypothetical protein
Escherichia coli M12
Length 89 aa, Gene n/a, UniProt n/a
>ATI08631.1|Escherichia coli M12|hypothetical protein
MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSAKDAVIPGLQKDYEEDFKTALLRARGVIKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.53 | 0.0049 | ●●○○○ -1.65 | -1.6500908154655274 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.14 | 6.5e-7 | ●●○○○ -1.57 | -1.5703880380224624 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)