Bacterial taxon 1392858
Locus CO715_24985
Protein ATI08662.1
hypothetical protein
Escherichia coli M12
Length 65 aa, Gene n/a, UniProt n/a
>ATI08662.1|Escherichia coli M12|hypothetical protein
MVIRKKKCRDCGNAITHNTVCCPYCGAVDPFGYYRKTDRLLCLLTLLLVLILVTVSGVSVFVLLQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.65 | 4.5e-9 | ○○○○○ 1.1 | 1.0992377142917173 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 5.5 | 2.7e-36 | ○○○○○ 1.69 | 1.692626978815479 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)