Bacterial taxon 1392858
Locus CO715_25085
Protein ATI08670.1
hypothetical protein
Escherichia coli M12
Length 305 aa, Gene n/a, UniProt n/a
>ATI08670.1|Escherichia coli M12|hypothetical protein
MVQKILSDKVMNERTNAYYSYYLGERNISVLPLNVYDPPERFIAYIKKNRENLNITLSDFELEQIISGMRLKALAFLVPLEKISWIAGSERACLFSWYLLMQFIQNNRAKISADLLQKNKLYLKEEYLEGNAFPSDSSTQFRQILRVLDILSDKNLRDEWIIQTKDRWMRAFKSKSPFSYLLPENEHECIWTWNYLKEKNIALDNLASFPGSADIYHAIHLSFDIWVTHPSASPDDIKNFRNSFNKAKAQRKYKKMQEDKVNVQFFLDAETRAQLKELSRARRLSTGEMLHDLIVEEYKRYRHSR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.74 | 0.0079 | ○○○○○ 0.18 | 0.18307306572496768 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.1 | 3.3e-14 | ○○○○○ 0.78 | 0.7762536842344802 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)