Bacterial taxon 1392858
Locus CO715_19675
Protein ATI07742.1
intracellular septation protein A
Escherichia coli M12
Length 179 aa, Gene n/a, UniProt n/a
>ATI07742.1|Escherichia coli M12|intracellular septation protein A
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVVFGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLNLAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.74 | 1.2e-6 | ●●○○○ -1.28 | -1.2768230959743145 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.65 | 0.00016 | ○○○○○ 1.31 | 1.3080923745548276 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)