Bacterial taxon 1392858
Locus CO715_23525
Protein ATI08419.1
iron export permease FetB
Escherichia coli M12
Length 259 aa, Gene n/a, UniProt n/a
>ATI08419.1|Escherichia coli M12|iron export permease FetB
MNSHNITNESLALALMLVVVAILISHKEKLALEKDILWSVGRAIIQLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAGITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLGATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVTFMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.59 | 0.022 | ○○○○○ 0.42 | 0.42405921218240245 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.71 | 0.0029 | ○○○○○ 0.69 | 0.6940471546204289 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)